PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00661.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 320aa    MW: 33862.2 Da    PI: 6.5889
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00661.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.8e-092670345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             +W+ e+d  + +a + +  +    W++Ia+ ++ g++ +q+k+++ 
  Rsa1.0_00661.1_g00028.1 26 AWSREDDIAFERALASHTDEsdeKWEKIAADVP-GKSVEQIKEHYE 70
                             7*****************99*************.**********95 PP

2Myb_DNA-binding41.82.4e-13137181347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Rsa1.0_00661.1_g00028.1 137 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 181
                              6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.7162277IPR017884SANT domain
SMARTSM007172.9E-92375IPR001005SANT/Myb domain
CDDcd001671.67E-82673No hitNo description
PfamPF002493.2E-82670IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-52669IPR009057Homeodomain-like
SuperFamilySSF466891.94E-92780IPR009057Homeodomain-like
PROSITE profilePS5129417.173130186IPR017930Myb domain
SuperFamilySSF466891.36E-16132187IPR009057Homeodomain-like
SMARTSM007173.2E-10134184IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.9E-17134184IPR006447Myb domain, plants
PfamPF002493.0E-11137181IPR001005SANT/Myb domain
CDDcd001671.04E-9137182No hitNo description
Gene3DG3DSA:1.10.10.601.6E-10137180IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
NFQVGLGFDC VKKMAVEEVS DGGSAAWSRE DDIAFERALA SHTDESDEKW EKIAADVPGK  60
SVEQIKEHYE LLVEDVSRIE SGCVPLPDYG SSPEGSNGHD GGGDDGGSGK KGGNSHAGES  120
NQGSKAKSEQ ERRKGIAWTE DEHRLFLLGL DKYGKGDWRS ISRNFVVTRT PTQVASHAQK  180
YFIRLNSMNK DRRRSSIHDI TSVGDADVST QQGPITGQNN TSNNHNNNNT GSAVAVAGGG  240
NKPAKQASSQ PPPGPPPMYG TTPSIGQPVT GPLVSAVGTP VNLPAPPHLA FGVHAAPVPG  300
APVNMGQMPY TVPRTPTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-152092476RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399351.10.0hypothetical protein EUTSA_v10014203mg
SwissprotQ8S9H76e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLE4MWT40.0E4MWT4_EUTHA; mRNA, clone: RTFL01-15-N01
TrEMBLV4LAV40.0V4LAV4_EUTSA; Uncharacterized protein
STRINGAT5G08520.11e-169(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-142MYB family protein